HORDB

ID: hor000888
Uniprot ID: Q9W6M9(33-61)
Protein name: Galanin
Gene name: GAL
Organism: Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
Family: Galanin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004966 galanin receptor activity; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031764 type 1 galanin receptor binding; GO:0031765 type 2 galanin receptor binding; GO:0031766 type 3 galanin receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0045944 positive regulation of transcription by RNA polymerase II
GO CC: GO:0005576 extracellular region

Sequence: GWTLNSAGYLLGPHAVDNHRSFNDKHGFT
Length: 29(33-61)
Propeptide: MQRCAGFLFLSLILCAALSETFGLVLSAKEKRGWTLNSAGYLLGPHAVDNHRSFNDKHGFTGKREIQPEEDIKAGNIGRPLADENIVRTVVEFLTYLHLKEAGALDNLPSPEETNES
Signal peptide: MQRCAGFLFLSLILCAALS
Modification: T29 Threonine amide
Glycosylation: NA
Mutagenesis: NA

Function: May regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract, growth hormone and insulin release and adrenal secretion.
Mechanism: NA
Cross BBB: NO
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000888_AF2.pdb

hor000888_ESM.pdb

Mass:	371211	Formula:	C144H207N43O42
Absent amino acids:	CEIMQ	Common amino acids:	G
pI:	7.8	Basic residues:	5
Polar residues:	12	Hydrophobic residues:	9
Hydrophobicity:	-65.86	Boman Index:	-4942
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	57.24
Instability Index:	895.52	Extinction Coefficient cystines:	6990
Absorbance 280nm:	249.64